Unitymedia modem defekt?

[xake]

hallo,

ich hatte vor ein paar tagen bei unitymedia angerufen, weil meine pings schlecht waren und mein internet ab und zu ausfaellt. mir wurde dann mitgeteilt, dass bei mir in 2 wochen ausgebaut werden wuerde, da die auslastung zum teil auf bis zu 98% steigt. was mich jedoch stutzen laesst ist, dass jedes mal wenn mein internet ausfaellt, mein modem auch nicht anpingbar ist.
ist das normal? eigentlich hat das doch nichts miteinander zu tun oder? ich dachte das modem wuerde nur in dem moment kein signal bekommen.

modem von motorola sb5102e, fritzbox 7170 dahinter...
ich pinge immer die 192.168.100.1 an, was auch sonst gut funktioniert!

ist das normal oder ist das modem kaputt und habe ich vielleicht deswegen die ausfaelle? (modemleuchten leuchten ganz normal wenn internet nicht geht!)

 

[Grothesk]

Logfile vom Modem?
Und schau mal nach deiner Tastatur. Da sind die Großbuchstaben sowie die Umlaute defekt.

 

[xake]

hallo, hier die logfiles:

Time Priority Code Description
2009-11-27 23:35:43 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-27 23:35:09 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:01:59 3-Critical R002.0 No Ranging Response received - T3 time-out (US 2)
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:02 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-27 02:45:18 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-27 02:45:18 3-Critical R004.0 Received Response to Broadcast Maintenance Request, But no Unicast Maintenance o
2009-11-27 02:44:44 4-Error C216.0 DCC rejected parameter invalid for context
2009-11-27 01:09:45 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-27 01:09:11 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-26 20:17:58 3-Critical R005.0 Started Unicast Maintenance Ranging - No Response received - T3 time-out
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:02 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-26 01:17:42 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-26 01:17:42 3-Critical R004.0 Received Response to Broadcast Maintenance Request, But no Unicast Maintenance o
2009-11-26 01:17:10 3-Critical R005.0 Started Unicast Maintenance Ranging - No Response received - T3 time-out
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:02 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-26 01:12:47 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-26 01:12:47 3-Critical R004.0 Received Response to Broadcast Maintenance Request, But no Unicast Maintenance o
2009-11-26 01:12:15 3-Critical R005.0 Started Unicast Maintenance Ranging - No Response received - T3 time-out
2009-11-25 19:56:57 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-25 19:56:23 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:02 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-25 19:14:14 5-Warning B502.6 TEK Invalid - Invalid Key Sequence Number
1970-01-01 00:06:15 3-Critical R002.0 No Ranging Response received - T3 time-out (US 3)
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-25 06:43:56 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-25 06:43:56 3-Critical R004.0 Received Response to Broadcast Maintenance Request, But no Unicast Maintenance o
2009-11-25 06:43:23 3-Critical R005.0 Started Unicast Maintenance Ranging - No Response received - T3 time-out
2009-11-22 01:02:45 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-22 01:02:11 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 19:41:54 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 19:41:20 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 19:41:10 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 17:21:57 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:06 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:40:47 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:40:13 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:11 4-Error D004.3 ToD request sent- No Response received
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 15:36:35 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-21 15:31:46 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:31:10 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 15:28:56 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:28:36 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 15:24:18 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:22:52 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 15:20:20 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:19:44 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 15:19:36 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:10 4-Error D004.3 ToD request sent- No Response received
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 14:42:11 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
1970-01-01 00:00:03 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 14:27:52 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 14:27:50 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 14:27:16 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 14:26:55 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:03 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 13:14:12 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 13:13:38 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 13:13:28 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 13:13:00 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 13:03:30 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 13:02:54 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 13:02:46 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 13:02:16 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 12:57:48 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 12:51:10 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 12:49:56 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 12:48:50 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 12:44:18 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 12:43:27 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:03 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 11:56:10 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-21 11:44:57 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 11:44:53 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:06 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 11:01:47 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 10:59:49 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 10:57:19 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 10:42:36 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 10:42:32 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 10:33:13 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 10:33:09 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 10:07:23 6-Notice M573.0 Modem Is Shutting Down and Rebooting...

hab 2 mal manuell neugestartet...
ich habe keine umlaute, da meine tastatur eine englische ist :>
und im internet schreibe ich alles klein, sorry
danke fuer die hilfe!

 

[Grothesk]

lssdltngvnnemtchnkrprfndstwskrmm

n frn schrb ch mmr hn mlte, srry

 

[xake]

"lass deine leitung von nem techniker ueberpruefen"
heisst das, dass das modem normal reagiert?

 

[Grothesk]

So sieht jedenfalls ein sauberes Logfile aus:

2009-11-25 21:26:27	7-Information	B403.0	Auth Comp
2009-11-18 21:26:47	7-Information	B403.0	Auth Comp
2009-11-11 21:36:41	7-Information	B401.0	Authorized
2009-11-10 20:02:06	7-Information	B401.0	Authorized
2009-11-06 16:47:33	7-Information	B403.0	Auth Comp
2009-10-30 16:47:38	7-Information	B403.0	Auth Comp

 

[xake]

laut hotline waere alles in ordnung...
die frage ist halt, ob es normal ist, dass das modem nicht anpingbar ist, wenn auch keine internetverbindung steht bzw die kurz ausfaellt...

denn mir wurde am telefon bestaetigt, dass mein knotenpunkt auf 98% auslastung steht und er in 2 wochen ausgebaut wird. unklar ist jetzt, ob die verbindungsabbrueche deswegen sind oder weil vllt das modem kaputt ist (fritzbox)

 

[Grothesk]

..............................