• Kunden aus Hessen und Nordrhein-Westfalen können über die Rufnummer 0221 / 466 191 00 Hilfe bei allen Problemen in Anspruch nehmen.
    Kunden aus Baden-Württemberg können über die Rufnummer 0711 / 54 888 150 Hilfe bei allen Problemen in Anspruch nehmen.

Unitymedia modem defekt?

Diskutiere modem defekt? im Internet und Telefon über das TV-Kabelnetz Forum im Bereich Internet und Telefon; hallo, ich hatte vor ein paar tagen bei unitymedia angerufen, weil meine pings schlecht waren und mein internet ab und zu ausfaellt. mir wurde...
  • modem defekt? Beitrag #1

xake

Beiträge
82
Punkte Reaktionen
0
hallo,

ich hatte vor ein paar tagen bei unitymedia angerufen, weil meine pings schlecht waren und mein internet ab und zu ausfaellt. mir wurde dann mitgeteilt, dass bei mir in 2 wochen ausgebaut werden wuerde, da die auslastung zum teil auf bis zu 98% steigt. was mich jedoch stutzen laesst ist, dass jedes mal wenn mein internet ausfaellt, mein modem auch nicht anpingbar ist.
ist das normal? eigentlich hat das doch nichts miteinander zu tun oder? ich dachte das modem wuerde nur in dem moment kein signal bekommen.

modem von motorola sb5102e, fritzbox 7170 dahinter...
ich pinge immer die 192.168.100.1 an, was auch sonst gut funktioniert!

ist das normal oder ist das modem kaputt und habe ich vielleicht deswegen die ausfaelle? (modemleuchten leuchten ganz normal wenn internet nicht geht!)
 
  • modem defekt? Beitrag #2
Logfile vom Modem?
Und schau mal nach deiner Tastatur. Da sind die Großbuchstaben sowie die Umlaute defekt.
 
  • modem defekt? Beitrag #3
hallo, hier die logfiles:

Time Priority Code Description
2009-11-27 23:35:43 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-27 23:35:09 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:01:59 3-Critical R002.0 No Ranging Response received - T3 time-out (US 2)
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:02 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-27 02:45:18 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-27 02:45:18 3-Critical R004.0 Received Response to Broadcast Maintenance Request, But no Unicast Maintenance o
2009-11-27 02:44:44 4-Error C216.0 DCC rejected parameter invalid for context
2009-11-27 01:09:45 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-27 01:09:11 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-26 20:17:58 3-Critical R005.0 Started Unicast Maintenance Ranging - No Response received - T3 time-out
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:02 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-26 01:17:42 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-26 01:17:42 3-Critical R004.0 Received Response to Broadcast Maintenance Request, But no Unicast Maintenance o
2009-11-26 01:17:10 3-Critical R005.0 Started Unicast Maintenance Ranging - No Response received - T3 time-out
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:02 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-26 01:12:47 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-26 01:12:47 3-Critical R004.0 Received Response to Broadcast Maintenance Request, But no Unicast Maintenance o
2009-11-26 01:12:15 3-Critical R005.0 Started Unicast Maintenance Ranging - No Response received - T3 time-out
2009-11-25 19:56:57 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-25 19:56:23 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:02 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-25 19:14:14 5-Warning B502.6 TEK Invalid - Invalid Key Sequence Number
1970-01-01 00:06:15 3-Critical R002.0 No Ranging Response received - T3 time-out (US 3)
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-25 06:43:56 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-25 06:43:56 3-Critical R004.0 Received Response to Broadcast Maintenance Request, But no Unicast Maintenance o
2009-11-25 06:43:23 3-Critical R005.0 Started Unicast Maintenance Ranging - No Response received - T3 time-out
2009-11-22 01:02:45 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-22 01:02:11 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 19:41:54 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 19:41:20 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 19:41:10 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 17:21:57 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:06 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:40:47 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:40:13 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:11 4-Error D004.3 ToD request sent- No Response received
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 15:36:35 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-21 15:31:46 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:31:10 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 15:28:56 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:28:36 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 15:24:18 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:22:52 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 15:20:20 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 15:19:44 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 15:19:36 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:10 4-Error D004.3 ToD request sent- No Response received
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 14:42:11 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
1970-01-01 00:00:03 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 14:27:52 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 14:27:50 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 14:27:16 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 14:26:55 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:03 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 13:14:12 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 13:13:38 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 13:13:28 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 13:13:00 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 13:03:30 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 13:02:54 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 13:02:46 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 13:02:16 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 12:57:48 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 12:51:10 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 12:49:56 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 12:48:50 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 12:44:18 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 12:43:27 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:03 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 11:56:10 6-Notice M573.0 Modem Is Shutting Down and Rebooting...
2009-11-21 11:44:57 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 11:44:53 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:06 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 11:01:47 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 10:59:49 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 10:57:19 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 10:42:36 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 10:42:32 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 10:33:13 6-Notice M571.1 Ethernet link up - ready to pass packets
2009-11-21 10:33:09 6-Notice M571.4 Ethernet link dormant - not currently active
1970-01-01 00:00:04 6-Notice M571.1 Ethernet link up - ready to pass packets
1970-01-01 00:00:03 6-Notice M571.4 Ethernet link dormant - not currently active
2009-11-21 10:07:23 6-Notice M573.0 Modem Is Shutting Down and Rebooting...

hab 2 mal manuell neugestartet...
ich habe keine umlaute, da meine tastatur eine englische ist :>
und im internet schreibe ich alles klein, sorry :p
danke fuer die hilfe!
 
  • modem defekt? Beitrag #4
lssdltngvnnemtchnkrprfndstwskrmm

n frn schrb ch mmr hn mlte, srry
 
  • modem defekt? Beitrag #5
"lass deine leitung von nem techniker ueberpruefen"
heisst das, dass das modem normal reagiert?
 
  • modem defekt? Beitrag #6
So sieht jedenfalls ein sauberes Logfile aus:
Code:
2009-11-25 21:26:27	7-Information	B403.0	Auth Comp
2009-11-18 21:26:47	7-Information	B403.0	Auth Comp
2009-11-11 21:36:41	7-Information	B401.0	Authorized
2009-11-10 20:02:06	7-Information	B401.0	Authorized
2009-11-06 16:47:33	7-Information	B403.0	Auth Comp
2009-10-30 16:47:38	7-Information	B403.0	Auth Comp
 
  • modem defekt? Beitrag #7
laut hotline waere alles in ordnung...
die frage ist halt, ob es normal ist, dass das modem nicht anpingbar ist, wenn auch keine internetverbindung steht bzw die kurz ausfaellt...

denn mir wurde am telefon bestaetigt, dass mein knotenpunkt auf 98% auslastung steht und er in 2 wochen ausgebaut wird. unklar ist jetzt, ob die verbindungsabbrueche deswegen sind oder weil vllt das modem kaputt ist (fritzbox)
 
  • modem defekt? Beitrag #8
..............................
 
Thema:

modem defekt?

modem defekt? - Ähnliche Themen

connect box nicht mehr erreichbar - kein internet - bitte HILFE: meine connectbox läuft seit Mitte 2021 völlig problemlos im bridge-mode, dahinter hängt eine FritzBox7390, Verbunden über LAN Kabel an der FB LAN1...
Unitymedia Wird der TC4400 nicht mehr unterstützt?! Kein Internet seit 3 Tagen!: Hallo Community! ich habe seit mehreren Tagen Internet komplett Ausfall! Fritzbox 7590 die nach TC4400 bei mir ihre Dienste tut, meldet mir...
Unitymedia Nach Wochen immer noch zu geringe Datenrate, Leitung angeblich ok: Nabend zusammen, ich habe ein Problem mit Unitymedia, was sich anscheinend nicht so schnell lösen wird – und ich stehe kurz davor, mich an...
Unitymedia Problem. Router/Modem Defekt oder Ping/Ddos attacken?: Hallo, vorab möchte ich klar stellen das meine Anfrage erst nach Gründlicher Recherche hier eingereicht wurde. Ich habe mich durch etliche Foren...
Unitymedia Modem Cisco 3208 mit 200Mbit/s behalten, trotz upgrade!: Hallo an alle, in dieser Nachricht will ich kurz beschreiben, wie ich von 3Play 50MBit/s - 2,5MBit/s auf 200MBit/s - 10MBit/s upgegraded wurde...
Oben